regulatory schedule raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-03-06 and is reviewed periodically as new material appears.
Melanotan-2 has not received marketing authorisation from major regulatory agencies for any therapeutic indication. Several jurisdictions classify it as a prescription-only medicine or a controlled substance when supplied for human use. Because approved products do not exist, material sold online usually sits outside pharmaceutical supply chains and formal quality oversight. Regulators have issued public notices describing the compound as unapproved. Enforcement varies, and the legal position differs between countries, which complicates any single general statement about its status.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Melanotan II is a synthetic peptide analog modeled on alpha-melanocyte-stimulating hormone, a naturally occurring signaling peptide involved in pigmentation. Its structure is a cyclic heptapeptide containing two non-natural substitutions, norleucine at position four and D-phenylalanine at position seven. These modifications resist enzymatic breakdown and extend the molecule's activity relative to the native hormone. The compound binds melanocortin receptors and is studied mainly as a pharmacological tool rather than a therapeutic product. It has never received approval as a medicine in any major jurisdiction.
The compound was developed in the late 1980s and 1990s by academic researchers investigating photoprotection. The rationale held that stimulating melanin production might reduce ultraviolet damage to skin and lower skin cancer risk. Early work examined receptor binding, pigment response, and short-term tolerability in small studies. That program did not produce an approved drug, and formal development stalled after early-phase trials. Whether induced pigmentation confers meaningful photoprotection remains an open question.
Outside regulated medicine, melanotan II circulates through online vendors as a research chemical, often marketed for tanning. Products sold this way vary widely in purity, concentration, and labeling accuracy, and independent testing has documented discrepancies. Published reports describe both pigment effects and adverse reactions, including nausea, flushing, and darkening of existing moles. Long-term safety data are sparse, and no large controlled trial has established a risk profile. Questions about cumulative effects on melanocytes remain unresolved in the literature.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved for therapeutic use | No marketing authorisation from major agencies |
| Legal classification | Varies by jurisdiction | Prescription-only or controlled in several countries |
| Common synonyms | Melanotan II; MT-II | Also referenced by catalogue codes |
| Typical analytical method | Reverse-phase HPLC | Often paired with mass spectrometry |
| Primary literature focus | Receptor pharmacology | Pigmentation and melanocortin signalling |
Quality assessment of research-grade peptide rests mainly on reversed-phase high-performance liquid chromatography for purity and on mass spectrometry for identity confirmation. A single main peak above a stated threshold, commonly ninety-eight percent by peak area, is the usual release criterion applied by suppliers. Independent analyses commissioned by laboratories and consumer organisations have repeatedly reported discrepancies between label claims and measured content, including truncated sequences, residual trifluoroacetate, and lower-than-declared peptide mass. Those findings do not establish that every supplier is unreliable, but they indicate that purity figures printed on a vial are claims requiring verification rather than settled facts.
Regulatory treatment varies by jurisdiction and has changed over time. In several countries the peptide is handled as an unapproved prescription medicine, and import or sale for human use is restricted, while elsewhere it falls under poisons or controlled-substance schedules. Enforcement activity against online vendors has been reported in Australia, New Zealand, the United Kingdom and the United States. Scholarly writing discusses melanotan-2 chiefly as an experimental tool and as a case study in unregulated peptide supply, and its precise legal position in any given country should be checked against current national schedules.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Lyophilized peptide powder is generally stored frozen, protected from light and moisture. Tryptophan residues are susceptible to oxidation, and the lactam bridge can hydrolyze under strongly acidic or basic conditions. Solutions prepared for laboratory work degrade faster than dry powder, and repeated freeze-thaw cycles accelerate loss. Common practice is to aliquot solutions before freezing and to avoid alkaline buffers. Reported stability windows vary with concentration, buffer, and temperature, so exact shelf lives are method-specific rather than universal.
Regulatory status differs by country, and in many places supplying the compound for human consumption is unlawful. Vendors frequently label material as intended for research use only, a designation that shifts stated purpose but does not create a legal pathway for personal use. Certificates of analysis accompanying such products vary widely in detail and provenance. Third-party testing exists but is voluntary, and results are rarely linked to a specific lot in a publicly verifiable way.
Identity testing for a synthetic peptide relies on several complementary methods. Reversed-phase high-performance liquid chromatography separates the target from related impurities and reports purity as a percentage of total peak area. Mass spectrometry confirms molecular mass and can reveal deletions or truncations. Amino acid analysis and peptide mapping provide sequence-level confirmation, while counter-ion content and residual solvents are measured separately. A purity figure alone does not establish identity, so a complete dataset combines chromatographic and spectrometric evidence.
No regulatory authority has approved melanotan-2 for human use, and several countries classify it as a prescription-only or controlled substance, which restricts lawful supply. Material sold online is generally labelled as a research chemical and is not required to meet pharmaceutical standards of identity or purity. Published human data consist mainly of small uncontrolled studies, case reports and adverse-event notifications, so the evidence base is descriptive rather than confirmatory. Whether repeated melanocyte stimulation alters long-term naevus behaviour remains an open question that no completed trial has resolved.
Melanotan-2 is a synthetic cyclic heptapeptide designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous tridecapeptide that regulates pigment production. Two modifications distinguish it from the natural hormone: norleucine replaces methionine at the N-terminus, which limits oxidation, and a D-phenylalanine substitution raises receptor affinity. The ring is closed through an aspartate-lysine lactam bridge, giving the molecule a constrained conformation. The free base has a molecular mass near 1024 daltons, and commercial material is usually supplied as an acetate salt. It appears in the literature as a research peptide rather than an approved therapeutic agent.
Receptor studies place melanotan-2 among non-selective melanocortin agonists, binding MC1R, MC3R, MC4R and MC5R rather than a single subtype. Activation of MC1R on cutaneous melanocytes raises tyrosinase activity and shifts pigment synthesis toward eumelanin, which is darker and more photostable than pheomelanin. Central receptors, particularly MC4R, are associated with appetite suppression and with reported effects on sexual function. Because subtype selectivity is low, the same molecule engages pigment, metabolic and vascular pathways at once, and this breadth is a common explanation offered for the range of adverse events described in user reports.
=== Sarcopenia and sarcopenic obesity === In a recently published scoping review led by Kalra, the current evidence linking sarcopenic obesity with cardiovascular disease has been summarised, along with proposed preventive and therapeutic strategies. He has published extensively to enable the diagnosis of sarcopenia and sarcopenic obesity in resource-constrained settings and has led the development of a South Asian consensus document on the subject.
=== Proteogenomics === In proteogenomics, proteomic technologies such as mass spectrometry are used for improving gene annotations. Parallel analysis of the genome and the proteome facilitates discovery of post-translational modifications and proteolytic events, especially when comparing multiple species (comparative proteogenomics).
=== Notable cases === In 1987, fifteen-year-old Mickey Hays, who had progeria, appeared along with Jack Elam in the documentary I Am Not a Freak. Elam and Hays first met during the filming of the 1986 film The Aurora Encounter, in which Hays was cast as an alien. The friendship that developed lasted until Hays died in 1992, on his 20th birthday. Elam said, "You know I've met a lot of people, but I've never met anybody that got next to me like Mickey." Harold Kushner, who among other things wrote the book When Bad Things Happen to Good People, had a son, Aaron, who died at the age of 14 in 1977 of progeria. Margaret Casey, a 29-year-old woman with progeria who was then believed to be the oldest survivor of the premature aging disease, died on Sunday, May 26, 1985. Casey, a freelance artist, was admitted to Yale New Haven Hospital on the night of May 25 with respiratory problems, which caused her death. Sam Berns was an American activist with the disease. He was the subject of the HBO documentary Life According to Sam. Berns also gave a TEDx talk titled "My Philosophy for a Happy Life" on December 13, 2013. Hayley Okines was an English progeria patient who spread awareness of the condition. Leon Botha, the South African painter and DJ who was known, among other things, for his work with the hip-hop duo Die Antwoord, lived with progeria. He died in 2011, aged 26. Alexandra Peraut is a Catalan girl with progeria; she has inspired the book Una nena entre vint milions ('A girl in 20 million'), a children's book to explain progeria to youngsters.
Sources: en.wikipedia.org
=== Average molar mass of mixtures === An average molar mass may be defined for mixtures of substances. This is particularly important in polymer science, where there is usually a molar mass distribution of non-uniform polymers so that different polymer molecules contain different numbers of monomer units. The average molar mass of mixtures
The allegation along with the article forces Jim's editor Edward Burgess to fire him; Jim subsequently meets Rishi at a bar, and the two go on a cocaine bender at the latter's apartment along with Dez Watkins, a man they met at the bar. Watkins gives them drugs and turns up the volume on Rishi's stereo before leaving, inciting a noise complaint that draws police to the apartment right as Jim overdoses and dies. Jim's death is later confirmed to be a murder, with Watkins revealed as an agent of Russian foreign intelligence who gave Jim cocaine laced with fentanyl.
Stachys affinis, commonly called crosne, Chinese artichoke, Japanese artichoke, knotroot, or artichoke betony, is a perennial herbaceous plant of the family Lamiaceae, originating from China. Its rhizome is a root vegetable that can be eaten raw, pickled, dried or cooked.
Traditional non-alcoholic beverage companies, like PepsiCo, Fuze Beverage, and The Coca-Cola Company. Major food companies, such as Nestlé, Altria, Kraft Foods, General Mills, and the Campbell Soup Company. Smaller-scaled private companies and specialized companies like POM Wonderful. Agricultural cooperatives, such as Ocean Spray and Sunsweet Growers.
Sources: en.wikipedia.org
Health professionals learn about the human body from illustrations, models, and demonstrations. Medical and dental students in addition gain practical experience, for example by dissection of cadavers. Human anatomy, physiology, and biochemistry are basic medical sciences, generally taught to medical students in their first year at medical school.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
In 1888 Friedrich Reinitzer examined the properties of various derivatives of cholesterol which now belong to the class of materials known as cholesteric liquid crystals. Previously, other researchers had observed distinct colour effects when cooling cholesterol derivatives just above the freezing point, but had not associated it with a new phenomenon. Reinitzer found that cholesteryl benzoate does not melt in the same way as most substances, but has two melting points. At 145.5 °C (293.9 °F) it melts into a cloudy liquid, and at 178.5 °C (353.3 °F) it melts again and the cloudy liquid becomes clear. The phenomenon is reversible. Reinitzer sought assistance to understand the phenomenon and, on 14 March 1888, he wrote to Otto Lehmann. They exchanged letters and samples. Lehmann examined the intermediate cloudy fluid, and reported seeing crystallites. Reinitzer's colleague Victor Leopold von Zepharovich also indicated that the intermediate "fluid" was crystalline. Reinitzer published his results, with credit to Lehmann and von Zepharovich, on 3 May 1888. By that time, Reinitzer had discovered and described three important features of liquid crystals (the term was coined by Lehmann in a 1904 monograph): the existence of two melting points, the reflection of circularly polarized light, and the ability to rotate the direction of polarized light. Reinitzer did not pursue the study of liquid crystals further, although in 1908 he had to defend his role in their discovery when Lehmann claimed the priority.
Sources: en.wikipedia.org
Major regulatory agencies have not approved it for any indication. Some countries permit it only under prescription frameworks, while others classify it as a controlled substance.
Much of the evidence comes from case reports and accounts of unregulated use rather than controlled trials. Differences in product purity and dosing add further variability.
Laboratory work focuses on receptor binding and cellular signalling. Observational reports document outcomes after use, and analytical chemists examine samples to assess content and purity.
It is a synthetic cyclic peptide designed as an analog of alpha-melanocyte-stimulating hormone. It acts on melanocortin receptors and is best known from research into pigmentation. It is not an approved pharmaceutical product.